PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000911724
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family NAC
Protein Properties Length: 362aa    MW: 40714.9 Da    PI: 7.9328
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000911724genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM174.92.4e-54171421128
            NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskk 96 
                    lppGfrFhPtdeel+++yL+kkv ++++++ ++i evd++k+ePw+Lp k+k +ek+wyfF+ rd+ky+tg r+nrat++gyWkatgkdke+++ +
  MDP0000911724  17 LPPGFRFHPTDEELISHYLHKKVIDTSFSC-KAIGEVDLNKSEPWELPWKAKMGEKKWYFFCVRDRKYPTGLRTNRATEAGYWKATGKDKEIYR-G 110
                    79****************************.88***************888999****************************************.9 PP

            NAM  97 gelvglkktLvfykgrapkgektdWvmheyrl 128
                    + lvg+kktLvfykgrapkgek++Wv+heyrl
  MDP0000911724 111 KFLVGMKKTLVFYKGRAPKGEKSNWVIHEYRL 142
                    99****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.71E-6214167IPR003441NAC domain
PROSITE profilePS5100558.30617167IPR003441NAC domain
PfamPF023655.4E-2818142IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 362 aa     Download sequence    Send to blast
MENVPAGIVE EEDHIDLPPG FRFHPTDEEL ISHYLHKKVI DTSFSCKAIG EVDLNKSEPW  60
ELPWKAKMGE KKWYFFCVRD RKYPTGLRTN RATEAGYWKA TGKDKEIYRG KFLVGMKKTL  120
VFYKGRAPKG EKSNWVIHEY RLDGKFSVHN LPKTAKNEWV ICRVFEKNSG GKKIHISGFV  180
SVGSLGNEIG PSGLPPLMDS SPYSAAKAKP ASESHYVPCF SNPDPTDVQR NQGNIFDYMN  240
NNTLFGVSSN TSNSFPIIPF PNSFYSAHNA PISPNFQFPC SNLLQDQSIL RALFENNAAN  300
MRQHSFKTER EMVSVSQETG LTSDMNTEIS SVMSNLDMSR RPFGDQDPPA AAAGLDNFWN  360
Y*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swp_D5e-5391739174NAC domain-containing protein 19
3swp_C5e-5391739174NAC domain-containing protein 19
3swp_B5e-5391739174NAC domain-containing protein 19
3swp_A5e-5391739174NAC domain-containing protein 19
3swm_D5e-5391739174NAC domain-containing protein 19
3swm_C5e-5391739174NAC domain-containing protein 19
3swm_B5e-5391739174NAC domain-containing protein 19
3swm_A5e-5391739174NAC domain-containing protein 19
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.169710.0cell culture| root
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF1981200.0KF198120.1 Malus hupehensis NAC domain protein (NAC57) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008374563.10.0PREDICTED: NAC domain-containing protein 100-like
SwissprotQ9FLJ21e-153NC100_ARATH; NAC domain-containing protein 100
TrEMBLS5RDR90.0S5RDR9_9R
STRINGPOPTR_0015s02170.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF40934171
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61430.11e-148NAC domain containing protein 100